PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 484660
Common NameARALYDRAFT_484660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 327aa    MW: 36339.3 Da    PI: 8.0741
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
484660genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.2e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g + R+ k+c++rw +yl
           484660 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGmLLRCSKSCRLRWTNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding50.26.1e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
           484660  68 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-23565IPR009057Homeodomain-like
PROSITE profilePS5129417.105962IPR017930Myb domain
SuperFamilySSF466895.5E-3011109IPR009057Homeodomain-like
SMARTSM007173.7E-141364IPR001005SANT/Myb domain
PfamPF002498.1E-161462IPR001005SANT/Myb domain
CDDcd001673.47E-111662No hitNo description
PROSITE profilePS5129423.73963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2466118IPR009057Homeodomain-like
SMARTSM007172.5E-1567115IPR001005SANT/Myb domain
PfamPF002493.2E-1468113IPR001005SANT/Myb domain
CDDcd001672.46E-1070113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGMLLRC SKSCRLRWTN  60
YLRPGIKRGN FTEHEEKMIV HLQALLGNRW AAIASYLPQR TDNDIKNYWN THLKKKLNKV  120
NQDSHQELDH SSLSSSPSSS SANSNSNISR GQWERRLQTD IHLAKKALSE ALSPAVAPII  180
TSTVTTTSSS AESRRSTSSA SGFLRTQETS TTYASSTENI AKLLKGWVKN SPKTQNSADQ  240
VASTNSEVKE GIKSDDRKDC AGTFQSFSEF DHSYQQAGFS PDHETKPDIT GCCSNQSQWS  300
LFEKWLFEDS GGQIGDILLD ENTNFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-251411758159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-251411758159MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2503390.0AF250339.1 Arabidopsis thaliana Myb30 (Myb30) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002875478.10.0hypothetical protein ARALYDRAFT_484660
SwissprotQ9SCU70.0MYB30_ARATH; Transcription factor MYB30
TrEMBLD7LM570.0D7LM57_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.5__652__AT3G28910.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.10.0myb domain protein 30